DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CG13898

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:131 Identity:43/131 - (32%)
Similarity:73/131 - (55%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLK 110
            ||.:||:|.|.:.||.|...:|...:|.||....:.:|.|..:.::.|..|.|...||:.||...
  Fly    15 DICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDLMTKI 79

  Fly   111 MAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSGDGEVSKEE 175
            .:...|:..:..|::.||.|:.|.:::..|:.|...|||:::|||..|:..:|:|.|||.::..:
  Fly    80 YSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGDGVINFRD 144

  Fly   176 F 176
            |
  Fly   145 F 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 43/131 (33%)
EFh 46..108 CDD:238008 21/61 (34%)
EFh 119..181 CDD:238008 20/58 (34%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 43/131 (33%)
EFh 18..77 CDD:298682 19/58 (33%)
EFh 88..148 CDD:238008 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.