DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CG13526

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster


Alignment Length:150 Identity:34/150 - (22%)
Similarity:84/150 - (56%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPTF---DLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKT 95
            :|:|   :|:.....:::.||:.:|....|.:...|:|:|:.::|:|..:.::..::..:.....
  Fly     1 MPSFSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDE 65

  Fly    96 GRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMI 160
            .|:....|:.:|..:||..||::.:.:.|:..|.||.|.::..:::.:...|||.:||::::::.
  Fly    66 ERLDLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDIC 130

  Fly   161 DEANVSGDGEVSKEEFLNLI 180
            ...::.|||.:|..:|:..:
  Fly   131 QAVDMDGDGRISLRDFVGFM 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 32/142 (23%)
EFh 46..108 CDD:238008 11/61 (18%)
EFh 119..181 CDD:238008 15/61 (25%)
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 32/143 (22%)
EFh 16..78 CDD:238008 11/61 (18%)
EFh 92..151 CDD:238008 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.