DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CG42750

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_724101.4 Gene:CG42750 / 35090 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster


Alignment Length:186 Identity:32/186 - (17%)
Similarity:63/186 - (33%) Gaps:74/186 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VSSASVMHSSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRAL 74
            |||..::..:||::               :.|:.:|.....|:            :.||||::.|
  Fly   665 VSSILLIIGAASVA---------------VPLALRVAASAPFE------------ERLRVAVQLL 702

  Fly    75 GFEP------------KK------------EDIKRMM---------DEIDKDKTGRIAFNDFLYL 106
            ...|            :|            ||::.:|         .::.:.|.|||:...:...
  Fly   703 DQVPLIDGHNDLPWNIRKFLHNKLNDFNFDEDLRNVMPWGRSHWSHTDLTRLKKGRISAQFWAAY 767

  Fly   107 MRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTD-EELQEMID 161
            :..:...:|:.|..::....             :||:......|||. ...|::||
  Fly   768 VPCEAQHRDAVQLTLEQIDV-------------IKRLTDRYSPQLTTCTSAQDIID 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 27/158 (17%)
EFh 46..108 CDD:238008 15/94 (16%)
EFh 119..181 CDD:238008 8/44 (18%)
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:279569 20/123 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.