DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CG17493

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster


Alignment Length:177 Identity:109/177 - (61%)
Similarity:144/177 - (81%) Gaps:2/177 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SSASVMHSSASISSR--AKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRA 73
            |:|:...:.|::.::  .::.:|...|.|:||.:||.|||:||||||.:.||:||.|||:|||||
  Fly     5 STAAGNANPATVPAKRGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRA 69

  Fly    74 LGFEPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFL 138
            ||||||||:||||:.:||||.:||||||.||.||.:||||||:.::::|||..||||.||.|||.
  Fly    70 LGFEPKKEEIKRMISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFR 134

  Fly   139 NLKRVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||||||:||||.||||||:||||||::..||||::||||.::|||:|
  Fly   135 NLKRVARELGETLTDEELREMIDEADLDNDGEVNQEEFLRIMKKTSL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 102/146 (70%)
EFh 46..108 CDD:238008 46/61 (75%)
EFh 119..181 CDD:238008 42/61 (69%)
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 106/156 (68%)
EFh 42..104 CDD:238008 46/61 (75%)
EFh 115..177 CDD:238008 42/61 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450087
Domainoid 1 1.000 81 1.000 Domainoid score I2946
eggNOG 1 0.900 - - E2759_KOG0028
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1522
Isobase 1 0.950 - 0 Normalized mean entropy S400
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - mtm1107
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
1211.860

Return to query results.
Submit another query.