DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CG31960

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster


Alignment Length:143 Identity:51/143 - (35%)
Similarity:86/143 - (60%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFND 102
            :||:.::..:|..:.|.|....|.|.:|||.:.|||||.:|.:.:::.|::|:|.|..|.||..:
  Fly     3 ELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEE 67

  Fly   103 FLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSG 167
            |..::..||.:.:..:::..||..||.:..|.||...|:.|...|||:|.|:||:|||.|.::..
  Fly    68 FCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQ 132

  Fly   168 DGEVSKEEFLNLI 180
            |..::.|||.|::
  Fly   133 DNHINFEEFTNMM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 51/143 (36%)
EFh 46..108 CDD:238008 22/61 (36%)
EFh 119..181 CDD:238008 25/62 (40%)
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 51/143 (36%)
EFh 12..72 CDD:238008 22/59 (37%)
EFh 84..146 CDD:238008 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.