DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and Cetn2

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_062278.2 Gene:Cetn2 / 26370 MGIID:1347085 Length:172 Species:Mus musculus


Alignment Length:166 Identity:101/166 - (60%)
Similarity:132/166 - (79%) Gaps:5/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIK 84
            ||.:.|.:.|.||     :|:..||.:|::||||||...||.|:.|||:||:||||||||||:||
Mouse    11 ASSAQRKRMSPKP-----ELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIK 70

  Fly    85 RMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGE 149
            :|:.||||:.||::.|:|||.:|..||:|||:.::::|||..||||.||.|||.|||||||||||
Mouse    71 KMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGE 135

  Fly   150 QLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            .|||||||||||||:..|||||:::|||.::|||:|
Mouse   136 NLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 94/146 (64%)
EFh 46..108 CDD:238008 38/61 (62%)
EFh 119..181 CDD:238008 44/61 (72%)
Cetn2NP_062278.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 8/24 (33%)
Required for self-assembly. /evidence=ECO:0000250 2..25 6/18 (33%)
PTZ00183 16..172 CDD:185503 99/161 (61%)
EFh 32..94 CDD:238008 38/61 (62%)
EFh 105..167 CDD:238008 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7579
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S400
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.