DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and SPOM_SPAC1687.14C

DIOPT Version :10

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_593132.1 Gene:SPOM_SPAC1687.14C / 2542111 PomBaseID:SPAC1687.14C Length:76 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:30/72 - (41%)
Similarity:43/72 - (59%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSGDGEVS 172
            ||:|     :::..:||..||....|.|.|.:|:|...:|||.||.|:||.|:|.|..  :|:||
pombe     7 RLEM-----DEEAEEAFDLFDVTHKGYIDFEDLRRSCAQLGENLTKEQLQLMLDLAGT--NGKVS 64

  Fly   173 KEEFLNL 179
            :|||..|
pombe    65 REEFAEL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 30/72 (42%)
SPOM_SPAC1687.14CNP_593132.1 EFh 13..72 CDD:238008 27/61 (44%)

Return to query results.
Submit another query.