DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cdc31

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_587797.1 Gene:cdc31 / 2539261 PomBaseID:SPCC1682.04 Length:176 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:63/169 - (37%)
Similarity:105/169 - (62%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSRAKKSKKPKLPT-----------FDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGF 76
            ::|||:..:...||           .:::..|:.||.:||.|||:.....|:..|||.|:|||||
pombe     4 NARAKRRSRASSPTPARLGGYAPLRVEITEEQRQDINEAFKLFDSDKDNAIDYHELRAAMRALGF 68

  Fly    77 EPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLK 141
            ..:|.::.:::.:.||...|.:...||:.:|..|:.|:|..:::.:||..||||.||.||..||:
pombe    69 NAEKSEVLKILRDFDKTGKGYLQMEDFVRVMTEKIVERDPLEEIKRAFELFDDDETGKISLRNLR 133

  Fly   142 RVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLI 180
            ||||||.|.:.|:||:.||:|.::..|||::::||:.::
pombe   134 RVAKELNENIDDQELEAMIEEFDLDQDGEINEQEFIAIM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 58/143 (41%)
EFh 46..108 CDD:238008 23/61 (38%)
EFh 119..181 CDD:238008 30/62 (48%)
cdc31NP_587797.1 PTZ00183 28..172 CDD:185503 58/143 (41%)
EFh 38..100 CDD:238008 23/61 (38%)
EFh 111..173 CDD:238008 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3224
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I1289
OMA 1 1.010 - - QHG53747
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm47074
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.