DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and Cetn4

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_665824.1 Gene:Cetn4 / 207175 MGIID:2677454 Length:168 Species:Mus musculus


Alignment Length:170 Identity:94/170 - (55%)
Similarity:130/170 - (76%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MHSSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKK 80
            |.||..|:....|.|..|:   :|:.:||.:||:||||||...:|.|:.|||::|:|||||||||
Mouse     1 MASSQRITLDQWKKKAAKV---ELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKK 62

  Fly    81 EDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAK 145
            |::|:::.||||:.||.|.|.||..:|.:||:|||..::::|||..||||.||.||..|:|||||
Mouse    63 EEVKQLIAEIDKEGTGTICFEDFFAIMSVKMSEKDEKEEILKAFKLFDDDATGSISLNNIKRVAK 127

  Fly   146 ELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||||.||::|||||:|||:..||||:::||||.::|||:|
Mouse   128 ELGENLTEDELQEMLDEADRDGDGEINEEEFLKMMKKTSL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 86/146 (59%)
EFh 46..108 CDD:238008 35/61 (57%)
EFh 119..181 CDD:238008 39/61 (64%)
Cetn4NP_665824.1 EFh_PEF 13..168 CDD:330173 90/158 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7579
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.