DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and R08D7.5

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_498986.3 Gene:R08D7.5 / 187699 WormBaseID:WBGene00011145 Length:168 Species:Caenorhabditis elegans


Alignment Length:153 Identity:48/153 - (31%)
Similarity:77/153 - (50%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FDTQCT----GFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGR------------IAFND 102
            |...||    ..::..:|::.:||||::|:...::.|..:|   |.||            :..::
 Worm    18 FAAMCTEQKPNLLKLSQLKMVLRALGYDPRNSKVQEMTRKI---KDGRSMVMGWHGEKDYMDVDE 79

  Fly   103 FLYLMRLKMAEKDSNQD-----MMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDE 162
            ....::.|..|.||.:|     |..||..||.:..|.|:..|||.|||||||.|.|.:..|||.|
 Worm    80 LWNALQSKDDEGDSTEDKVTTEMRSAFKLFDPESKGTITVANLKMVAKELGETLADADFDEMIRE 144

  Fly   163 ANVSGDGEVSKEEFLNLIKKTNL 185
            |....:..:::::|..::|||.|
 Worm   145 AGGDNNTGINEQQFFEIMKKTCL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 47/151 (31%)
EFh 46..108 CDD:238008 14/69 (20%)
EFh 119..181 CDD:238008 26/66 (39%)
R08D7.5NP_498986.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S400
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.