DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and K03A1.4

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001041263.2 Gene:K03A1.4 / 186916 WormBaseID:WBGene00019352 Length:184 Species:Caenorhabditis elegans


Alignment Length:177 Identity:52/177 - (29%)
Similarity:91/177 - (51%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SMVSSASVMHSSASISSRAKKSKKPKLPTFDLSLS---QKV-DIKKAFDLFDTQCTGFIETKELR 68
            |..||.|....|||..:...|....:..|..::.|   .|: :.|:||:.||....|.|...||.
 Worm     4 STYSSRSSTKQSASTKNAHGKFTSKERETTQITASNCKNKIEEYKRAFNFFDANNDGRITIDELE 68

  Fly    69 VAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMK-AFSFFDDDRT 132
            .|::..|.:|.|.:::.:|...|.|:.|.|.|::|.:||....:......|.:: .|..||.|:.
 Worm    69 KAMQKCGQKPTKLELRLIMYHGDNDQNGVITFDEFAHLMNGTASMNQYTYDQLREQFDMFDKDKD 133

  Fly   133 GGISFLNLKRVAKELGEQLT--DEELQEMIDEANVSGDGEVSKEEFL 177
            |.|..:.:..:.:||..|.:  .:.::::.:||::.|||::|.|||:
 Worm   134 GFIEKMEMLSIVRELSLQASFPRQVVEQLFNEADIDGDGKISFEEFV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 43/147 (29%)
EFh 46..108 CDD:238008 21/61 (34%)
EFh 119..181 CDD:238008 19/62 (31%)
K03A1.4NP_001041263.2 PTZ00184 43..180 CDD:185504 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.