DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cal-1

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:173 Identity:57/173 - (32%)
Similarity:96/173 - (55%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSASISSRAKKSKKPKLPTFDLSLSQKV----------DIKKAFDLFDTQCTGFIETKELRVAIR 72
            ||......|.::::..:|:..:..|:.:          :.::||.:||....|.|.||||.:|:|
 Worm     6 SSRLARDMAIRAERMAIPSNLMQFSEDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMR 70

  Fly    73 ALGFEPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISF 137
            :||..|.:::|..|::|:|.|..|:|.|.:|..:|:..|.|.||.. :.:||..||.|..|.|:.
 Worm    71 SLGQNPTEQEILEMINEVDIDGNGQIEFPEFCVMMKRMMKETDSEM-IREAFRVFDKDGNGVITA 134

  Fly   138 LNLKRVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLI 180
            ...:.....:|.|.::||:.|||.|.:|.||||:..|||:.::
 Worm   135 QEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEFVKMM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 53/153 (35%)
EFh 46..108 CDD:238008 24/61 (39%)
EFh 119..181 CDD:238008 23/62 (37%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 52/141 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.