DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and Cetn3

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006517137.1 Gene:Cetn3 / 12626 MGIID:1097706 Length:183 Species:Mus musculus


Alignment Length:153 Identity:68/153 - (44%)
Similarity:105/153 - (68%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRM 86
            :..:.|:.|:.     :||..||.:||.||:||||.....|:..||:||:|||||:.||.|:.::
Mouse    10 VVDKTKRKKRR-----ELSEEQKQEIKDAFELFDTDKDQAIDYHELKVAMRALGFDVKKADVLKI 69

  Fly    87 MDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQL 151
            :.:.|::.||:|.|.||..::...:.|:|.:::::|||..||||.:|.||..||:|||:||||.:
Mouse    70 LKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENM 134

  Fly   152 TDEELQEMIDEANVSGDGEVSKE 174
            :||||:.||:|.:..||||.|:|
Mouse   135 SDEELRAMIEEFDKDGDGERSRE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 66/137 (48%)
EFh 46..108 CDD:238008 28/61 (46%)
EFh 119..181 CDD:238008 32/56 (57%)
Cetn3XP_006517137.1 PTZ00183 15..157 CDD:185503 67/146 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.