DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CETN3

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001284694.1 Gene:CETN3 / 1070 HGNCID:1868 Length:191 Species:Homo sapiens


Alignment Length:159 Identity:69/159 - (43%)
Similarity:106/159 - (66%) Gaps:5/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDI 83
            |..:..:.|:.|:.     :||..||.:||.||:||||.....|:..||:||:|||||:.||.|:
Human     7 SELVVDKTKRKKRR-----ELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADV 66

  Fly    84 KRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELG 148
            .:::.:.|::.||:|.|.||..::...:.|:|.:::::|||..||||.:|.||..||:|||:|||
Human    67 LKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELG 131

  Fly   149 EQLTDEELQEMIDEANVSGDGEVSKEEFL 177
            |.::||||:.||:|.:..||||:.|...|
Human   132 ENMSDEELRAMIEEFDKDGDGEILKNILL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 66/140 (47%)
EFh 46..108 CDD:238008 28/61 (46%)
EFh 119..181 CDD:238008 32/59 (54%)
CETN3NP_001284694.1 PTZ00183 15..190 CDD:185503 68/151 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.