DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CETN1

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_004057.1 Gene:CETN1 / 1068 HGNCID:1866 Length:172 Species:Homo sapiens


Alignment Length:168 Identity:97/168 - (57%)
Similarity:133/168 - (79%) Gaps:5/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKED 82
            |:||...:.|.:.||     :|:..||.::::||||||...:|.|:.|||:||:|||||||:||:
Human     9 SAASTGQKRKVAPKP-----ELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEE 68

  Fly    83 IKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKEL 147
            :|:|:.|:|::.||:|:|||||.:|..||:|||:.::::|||..||||.||.|||.||||||.||
Human    69 MKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANEL 133

  Fly   148 GEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||.|||||||||||||:..|||||::||||.::|||:|
Human   134 GENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 90/146 (62%)
EFh 46..108 CDD:238008 34/61 (56%)
EFh 119..181 CDD:238008 44/61 (72%)
CETN1NP_004057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 8/26 (31%)
PTZ00183 22..172 CDD:185503 93/155 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147876
Domainoid 1 1.000 90 1.000 Domainoid score I7772
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.