DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn4

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_012810447.1 Gene:cetn4 / 100144661 XenbaseID:XB-GENE-920656 Length:171 Species:Xenopus tropicalis


Alignment Length:174 Identity:99/174 - (56%)
Similarity:131/174 - (75%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASVMHS-SASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGF 76
            |||:.. ....:.|.:...||     :|:..||.:|::|||||||..:|.|:.|||:||:|||||
 Frog     2 ASVLRKPGLGATQRRRIGAKP-----ELTEEQKQEIREAFDLFDTDGSGTIDVKELKVAMRALGF 61

  Fly    77 EPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLK 141
            |||||::|:::.:.|||.:|.|.|.|||.||..||:||||.:::||||..||||.||.|||.|||
 Frog    62 EPKKEEMKKIISDTDKDGSGIIDFEDFLSLMTQKMSEKDSKEEIMKAFRLFDDDNTGKISFKNLK 126

  Fly   142 RVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||||||||.|||||||||||||:..||||::::|||.:::||:|
 Frog   127 RVAKELGENLTDEELQEMIDEADRDGDGEINEQEFLRIMRKTSL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 92/146 (63%)
EFh 46..108 CDD:238008 36/61 (59%)
EFh 119..181 CDD:238008 44/61 (72%)
cetn4XP_012810447.1 PTZ00183 15..170 CDD:185503 95/159 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7658
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.