DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn2

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_001345066.1 Gene:cetn2 / 100006257 ZFINID:ZDB-GENE-091118-94 Length:172 Species:Danio rerio


Alignment Length:168 Identity:102/168 - (60%)
Similarity:134/168 - (79%) Gaps:5/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKED 82
            |..:::.|.|.|     |..:|:..||.:|::||:||||..:|:||.|||:||:||||||||||:
Zfish     9 SLGAVAPRKKAS-----PKSELTEEQKQEIREAFELFDTDGSGYIEVKELKVAMRALGFEPKKEE 68

  Fly    83 IKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKEL 147
            ||:|:.|:||:.||:|:|.|||.:|..|||||||.::::|||..||||.||.|||.|||||||||
Zfish    69 IKKMIAEVDKEATGKISFTDFLSVMTQKMAEKDSKEEILKAFRLFDDDETGKISFRNLKRVAKEL 133

  Fly   148 GEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||.|||||||||||||:..|||||:::|||.::|||:|
Zfish   134 GENLTDEELQEMIDEADRDGDGEVNQQEFLRIMKKTSL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 96/146 (66%)
EFh 46..108 CDD:238008 38/61 (62%)
EFh 119..181 CDD:238008 44/61 (72%)
cetn2XP_001345066.1 PTZ00183 16..172 CDD:185503 101/161 (63%)
EFh 32..94 CDD:238008 38/61 (62%)
EFh 105..167 CDD:238008 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581754
Domainoid 1 1.000 94 1.000 Domainoid score I7413
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.