DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31800 and C1orf50

DIOPT Version :10

Sequence 1:NP_724152.1 Gene:CG31800 / 318947 FlyBaseID:FBgn0051800 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_077002.2 Gene:C1orf50 / 79078 HGNCID:28795 Length:199 Species:Homo sapiens


Alignment Length:130 Identity:58/130 - (44%)
Similarity:92/130 - (70%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DIIELAQQIQNADKQLKNTTCQKLGVIMEQIKMLQAQAMEILKESTLNRDLHSAACNFTKKPGHI 100
            |::.||:|:|.||:.::.....||.||.|||:.||.||.::|:::..:.:||..|||..||||:|
Human    55 DLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNI 119

  Fly   101 YHLYQRPSGQNYFSMLSPEEWSLSVDQTFKGSYRLEYDLSWTPLDKIKEQDEKLKWAEQCMLKAL 165
            |:||:|.|||.|||::||:||..|....|.|:|:|::||||||.:.|::||.|:...:..:.:::
Human   120 YYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSV 184

  Fly   166  165
            Human   185  184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31800NP_724152.1 DUF2452 13..161 CDD:463120 58/124 (47%)
C1orf50NP_077002.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
DUF2452 28..182 CDD:463120 58/126 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.