DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31800 and zgc:112255

DIOPT Version :9

Sequence 1:NP_724152.1 Gene:CG31800 / 318947 FlyBaseID:FBgn0051800 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001018505.1 Gene:zgc:112255 / 553695 ZFINID:ZDB-GENE-050522-57 Length:189 Species:Danio rerio


Alignment Length:145 Identity:60/145 - (41%)
Similarity:97/145 - (66%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVE--RNP--QLQINPMRVS-MHQEEDIIELAQQIQNADKQLKNTTCQKLGVIMEQIKMLQAQAM 74
            |||  .||  .:.::|.:.: :....|::.||||:|..|:.::...|.:|.||.:||:.||.||.
Zfish    19 LVETSSNPSGMVLVSPYQTNRVGDPMDLVSLAQQVQKGDEFIRANACNRLTVIADQIRYLQEQAR 83

  Fly    75 EILKESTLNRDLHSAACNFTKKPGHIYHLYQRPSGQNYFSMLSPEEWSLSVDQTFKGSYRLEYDL 139
            ::|:::..:.:||.||||..||||::|:||.|.|||.|||:|||.||..|....|.|.|:|::|:
Zfish    84 KVLEDARKDAELHHAACNVVKKPGNMYYLYMRESGQRYFSILSPREWGASCPHKFLGGYKLQHDM 148

  Fly   140 SWTPLDKIKEQDEKL 154
            ||||.:.::::|.::
Zfish   149 SWTPQEDVEKRDAEI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31800NP_724152.1 DUF2452 17..161 CDD:287475 58/143 (41%)
zgc:112255NP_001018505.1 DUF2452 21..172 CDD:287475 58/143 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585948
Domainoid 1 1.000 129 1.000 Domainoid score I5233
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11461
Inparanoid 1 1.050 129 1.000 Inparanoid score I4638
OMA 1 1.010 - - QHG52612
OrthoDB 1 1.010 - - D1483939at2759
OrthoFinder 1 1.000 - - FOG0006158
OrthoInspector 1 1.000 - - oto38667
orthoMCL 1 0.900 - - OOG6_108307
Panther 1 1.100 - - LDO PTHR14553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2933
SonicParanoid 1 1.000 - - X4442
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.900

Return to query results.
Submit another query.