DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31800 and c1orf50

DIOPT Version :9

Sequence 1:NP_724152.1 Gene:CG31800 / 318947 FlyBaseID:FBgn0051800 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001016665.1 Gene:c1orf50 / 549419 XenbaseID:XB-GENE-1004912 Length:184 Species:Xenopus tropicalis


Alignment Length:154 Identity:69/154 - (44%)
Similarity:100/154 - (64%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKKAQLVERNPQLQINP---MRVSMHQ------EEDIIELAQQIQNADKQLKNTTCQKLGVIMEQ 65
            |....|||.|    .||   ..||.:|      ..::::||:|:|.||:.::...|.:|.||.||
 Frog     9 VTTVALVESN----ANPTGVQLVSTYQTNRIGDPSNLVDLARQVQKADEFVRANACNRLTVIAEQ 69

  Fly    66 IKMLQAQAMEILKESTLNRDLHSAACNFTKKPGHIYHLYQRPSGQNYFSMLSPEEWSLSVDQTFK 130
            |:|||.||..:|:|:..:.|||.||||..||||:||:||||.|||.|||:|||:||..|....|.
 Frog    70 IRMLQEQARRVLEEAKRDADLHHAACNVVKKPGNIYYLYQRESGQRYFSILSPKEWGPSCPHEFL 134

  Fly   131 GSYRLEYDLSWTPLDKIKEQDEKL 154
            .:|:|::|:||||.:.|:::|.::
 Frog   135 AAYKLQHDMSWTPFENIEKRDAEI 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31800NP_724152.1 DUF2452 17..161 CDD:287475 66/147 (45%)
c1orf50NP_001016665.1 DUF2452 16..166 CDD:371098 66/147 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4908
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11461
Inparanoid 1 1.050 136 1.000 Inparanoid score I4445
OMA 1 1.010 - - QHG52612
OrthoDB 1 1.010 - - D1483939at2759
OrthoFinder 1 1.000 - - FOG0006158
OrthoInspector 1 1.000 - - oto104172
Panther 1 1.100 - - LDO PTHR14553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2933
SonicParanoid 1 1.000 - - X4442
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.