DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31800 and C08B11.9

DIOPT Version :9

Sequence 1:NP_724152.1 Gene:CG31800 / 318947 FlyBaseID:FBgn0051800 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001021934.1 Gene:C08B11.9 / 3564855 WormBaseID:WBGene00007436 Length:186 Species:Caenorhabditis elegans


Alignment Length:175 Identity:58/175 - (33%)
Similarity:96/175 - (54%) Gaps:22/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QLVERNPQLQINPMRVSMHQE---------------EDIIELAQQIQNADKQLKNTTCQKLGVIM 63
            ||.:|..::.: |:..|..::               :|::.||.|:.:|.:.:|...|.:|..|.
 Worm     9 QLPQRGERINV-PLVQSRSEDQRLVTSARQTDKIDADDLVALANQLNSARQLVKGRACDRLKQIA 72

  Fly    64 EQIKMLQAQAMEILKESTLNRDLHSAACNFTKKPGHIYHLYQRPSGQN-YFSMLSPEEWSL-SVD 126
            :|::.|...|..:|:::..:..||:..||..|:||.||||||:....| |||||:|.||.. ...
 Worm    73 DQMEQLHMAARAVLEDAQRDEHLHNVPCNMEKQPGRIYHLYQKQGSMNKYFSMLAPNEWGYQEKK 137

  Fly   127 QTFKGSYRLEYDLSWTPLDKIKEQDEKLKWAEQCMLK----ALDG 167
            :.:.||||||||.||||:.::..:||::...:|.:.:    ||.|
 Worm   138 EEYLGSYRLEYDRSWTPVGEMDRKDEEVARLQQLLQREGPVALRG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31800NP_724152.1 DUF2452 17..161 CDD:287475 53/160 (33%)
C08B11.9NP_001021934.1 DUF2452 29..174 CDD:287475 50/144 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162090
Domainoid 1 1.000 108 1.000 Domainoid score I4072
eggNOG 1 0.900 - - E1_2CHIC
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11461
Inparanoid 1 1.050 108 1.000 Inparanoid score I3491
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52612
OrthoDB 1 1.010 - - D1483939at2759
OrthoFinder 1 1.000 - - FOG0006158
OrthoInspector 1 1.000 - - oto18438
orthoMCL 1 0.900 - - OOG6_108307
Panther 1 1.100 - - LDO PTHR14553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2933
SonicParanoid 1 1.000 - - X4442
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.