DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31800 and RGD1564804

DIOPT Version :9

Sequence 1:NP_724152.1 Gene:CG31800 / 318947 FlyBaseID:FBgn0051800 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001101439.1 Gene:RGD1564804 / 313551 RGDID:1564804 Length:199 Species:Rattus norvegicus


Alignment Length:126 Identity:57/126 - (45%)
Similarity:89/126 - (70%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DIIELAQQIQNADKQLKNTTCQKLGVIMEQIKMLQAQAMEILKESTLNRDLHSAACNFTKKPGHI 100
            |::.||:|:|.||:.::.....||.||.|||:.||.||.::|:::..:.|||..|||..||||:|
  Rat    55 DLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQDQARKVLEDARRDADLHHVACNMVKKPGNI 119

  Fly   101 YHLYQRPSGQNYFSMLSPEEWSLSVDQTFKGSYRLEYDLSWTPLDKIKEQDEKLKWAEQCM 161
            |:||||.|||.|||::||:||.......|.|:|:|::|:||||.:.:::||.|:...::.:
  Rat   120 YYLYQRESGQKYFSIISPQEWGAGCPHDFLGAYKLQHDMSWTPYEDVEKQDAKISMMDKLL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31800NP_724152.1 DUF2452 17..161 CDD:287475 57/124 (46%)
RGD1564804NP_001101439.1 DUF2452 31..182 CDD:287475 57/126 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344981
Domainoid 1 1.000 133 1.000 Domainoid score I4947
eggNOG 1 0.900 - - E1_2CHIC
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11461
Inparanoid 1 1.050 133 1.000 Inparanoid score I4510
OMA 1 1.010 - - QHG52612
OrthoDB 1 1.010 - - D1483939at2759
OrthoFinder 1 1.000 - - FOG0006158
OrthoInspector 1 1.000 - - oto97480
orthoMCL 1 0.900 - - OOG6_108307
Panther 1 1.100 - - LDO PTHR14553
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4442
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.