DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31800 and AU022252

DIOPT Version :9

Sequence 1:NP_724152.1 Gene:CG31800 / 318947 FlyBaseID:FBgn0051800 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001012400.1 Gene:AU022252 / 230696 MGIID:2140466 Length:199 Species:Mus musculus


Alignment Length:119 Identity:59/119 - (49%)
Similarity:87/119 - (73%) Gaps:0/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DIIELAQQIQNADKQLKNTTCQKLGVIMEQIKMLQAQAMEILKESTLNRDLHSAACNFTKKPGHI 100
            |::.||:|:|.||:.::.....||.||.|||:.||.||.::|:::..:.|||.||||..||||:|
Mouse    55 DLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDARRDADLHHAACNMVKKPGNI 119

  Fly   101 YHLYQRPSGQNYFSMLSPEEWSLSVDQTFKGSYRLEYDLSWTPLDKIKEQDEKL 154
            |:||||.|||.|||::|||||.......|.|:|:|::|:||||.:.:::||.|:
Mouse   120 YYLYQRESGQQYFSIISPEEWGTGCPHDFLGAYKLQHDMSWTPYEDVEKQDAKI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31800NP_724152.1 DUF2452 17..161 CDD:287475 59/119 (50%)
AU022252NP_001012400.1 DUF2452 31..182 CDD:287475 59/119 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841620
Domainoid 1 1.000 135 1.000 Domainoid score I4964
eggNOG 1 0.900 - - E1_2CHIC
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11461
Inparanoid 1 1.050 135 1.000 Inparanoid score I4556
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52612
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006158
OrthoInspector 1 1.000 - - oto93948
orthoMCL 1 0.900 - - OOG6_108307
Panther 1 1.100 - - LDO PTHR14553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2933
SonicParanoid 1 1.000 - - X4442
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.