DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31789 and CG33998

DIOPT Version :9

Sequence 1:NP_001286049.1 Gene:CG31789 / 318943 FlyBaseID:FBgn0051789 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001033959.1 Gene:CG33998 / 3885594 FlyBaseID:FBgn0053998 Length:119 Species:Drosophila melanogaster


Alignment Length:122 Identity:35/122 - (28%)
Similarity:59/122 - (48%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKALQFALVFSAILAIAFAA------NASWGAKLSSSKLVSTQNVTIYKKANQYVSSLISFPLAG 59
            ||.....||| |:.|.|.|:      :.:|||:......:..:.:|...|..:.|:.  .|....
  Fly     1 MKIYVILLVF-ALTAFAAASGRGRSHSITWGARTYRDMHLHREIITEKSKFLRVVTR--EFVFDQ 62

  Fly    60 QSNTKTIRYISITDRFTNSSGPYSTLWSGGPGFINAQVNVTSQFSQGINVTAQFWVD 116
            :...:||..|.|||:..:.:|.|:.|.:|||....|::::.||.:||.:    |.:|
  Fly    63 KKLARTITQIVITDQIRDGNGGYAYLTAGGPQTTYAKIHLKSQRNQGFS----FIID 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31789NP_001286049.1 MBF2 24..114 CDD:292493 24/89 (27%)
CG33998NP_001033959.1 MBF2 29..118 CDD:292493 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.