DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31789 and CG13323

DIOPT Version :9

Sequence 1:NP_001286049.1 Gene:CG31789 / 318943 FlyBaseID:FBgn0051789 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001286370.1 Gene:CG13323 / 36433 FlyBaseID:FBgn0033788 Length:112 Species:Drosophila melanogaster


Alignment Length:114 Identity:37/114 - (32%)
Similarity:61/114 - (53%) Gaps:7/114 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQFALVFSAILAI---AFAANASWGAKLSSSKLVSTQNVTIYKKANQYVSSLISFPLAGQSNTKT 65
            ::..|:.|.:||:   ..|..|:||.:.::..|:|..........|.|.:..:::| ||..|   
  Fly     1 MRLLLILSVVLAVILGCHAYGATWGRRNNNDYLLSRTTEVRNPIKNNYWNVNVNYP-AGFYN--- 61

  Fly    66 IRYISITDRFTNSSGPYSTLWSGGPGFINAQVNVTSQFSQGINVTAQFW 114
            |..:.:.|.|.|:||...:|:|||||:..|.||:..|.::|||.|.:.|
  Fly    62 ISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRGINSTVEIW 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31789NP_001286049.1 MBF2 24..114 CDD:292493 30/89 (34%)
CG13323NP_001286370.1 MBF2 24..111 CDD:292493 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016726
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.