DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31789 and CG30413

DIOPT Version :10

Sequence 1:NP_724118.1 Gene:CG31789 / 318943 FlyBaseID:FBgn0051789 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_726308.1 Gene:CG30413 / 246601 FlyBaseID:FBgn0050413 Length:122 Species:Drosophila melanogaster


Alignment Length:85 Identity:23/85 - (27%)
Similarity:38/85 - (44%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SWGAKLSSSKLVSTQNVTIYKKANQYVSSLISFPLAGQSNTKTIRYISITDRFTNSSGPYSTLWS 87
            ::|.:.::..|::::.:|..|......:...:...||  ..|||.||.||| .....|..:.:.|
  Fly    31 TYGTQATTDTLIASETITKSKSLLGITTKTYTLTQAG--TAKTITYIKITD-LKKMRGATAEITS 92

  Fly    88 GGPGFINAQVNVTSQFSQGI 107
            ||.|.....:..||....||
  Fly    93 GGVGSTTVTIKFTSARGAGI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31789NP_724118.1 MBF2 24..114 CDD:464913 23/84 (27%)
CG30413NP_726308.1 MBF2 32..120 CDD:464913 23/84 (27%)

Return to query results.
Submit another query.