DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and AT3G22845

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_188924.3 Gene:AT3G22845 / 821856 AraportID:AT3G22845 Length:214 Species:Arabidopsis thaliana


Alignment Length:231 Identity:51/231 - (22%)
Similarity:94/231 - (40%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIWLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQEC-----FYQPIATTEN-IKIDYQVI----H 61
            |..|:.|:||..:        |:..::......:||     .|:....:.| :.:|:.:.    |
plant    10 VFVLIGLILLNSI--------NQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSDH 66

  Fly    62 GGLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAP 126
            .||     :|.:..|:..::.........|...:|.::|.|||||.|..||  .:.|||.:.|..
plant    67 PGL-----DFTVTSPAGNIVQTLKGTSGDKFEFKAPKSGMYKFCFHNPYST--PETVSFYIHVGH 124

  Fly   127 ADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQT-------QDFIRAIEARDRN 184
            ...|        .::..|.|.|           .::|.:...|:.       |.:::|.:.|.|:
plant   125 IPNE--------HDLAKDEHLD-----------PVNVKIAELREALESVVAEQKYLKARDTRHRH 170

  Fly   185 VAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIFN 220
            ..|||...|..::..:::.:.....||||.:|.:|:
plant   171 TNESTRKRVIFYTVGEYIFLAAASGLQVLYIRKLFS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/206 (21%)
AT3G22845NP_188924.3 EMP24_GP25L 33..205 CDD:395878 44/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.