DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and AT2G03040

DIOPT Version :10

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_178404.1 Gene:AT2G03040 / 814833 AraportID:AT2G03040 Length:166 Species:Arabidopsis thaliana


Alignment Length:99 Identity:23/99 - (23%)
Similarity:39/99 - (39%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVI-----HGGLGETH-INF 71
            |||::.|    ..|....:....::.:.:|..:.|.........|.::     |..|.::| |..
plant     9 LLLIIAL----LSPRTLSMRYELKSSKTKCIGEEIHENAMSIGKYFIVNPNEDHHPLPDSHKIIV 69

  Fly    72 NLMDPSRRLLIAETKRQMGKHSIQANETGSYKFC 105
            .:|.|..:.|......:.|:.|..|.|.|||..|
plant    70 KVMPPQGKNLHEADNVEAGQFSFTAYENGSYVAC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 31..220 CDD:426051 18/81 (22%)
AT2G03040NP_178404.1 EMP24_GP25L 22..>166 CDD:426051 18/82 (22%)

Return to query results.
Submit another query.