DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed1b

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001074109.1 Gene:tmed1b / 791158 ZFINID:ZDB-GENE-070112-1112 Length:226 Species:Danio rerio


Alignment Length:224 Identity:76/224 - (33%)
Similarity:115/224 - (51%) Gaps:16/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHG-GLGETHINFNL 73
            ||..:.||....:...|.:.:.|....|..:|||||......:::|:||||.| |:   .::|::
Zfish    11 LLGYVTLLFGAVNAFSPADTEFTFLLPAASKECFYQSAVHNGSVEIEYQVIAGAGM---DVDFSV 72

  Fly    74 MDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEV------APADREER 132
            :.|....||:|.:|..|.|.::..|.|.|:.|||||.|..::|:|.|.:.:      |.||.|..
Zfish    73 VSPQGIHLISEFRRSDGVHMVEPTEEGDYQICFDNTFSRLSEKMVFFEVILDHPSNDAGADDEWA 137

  Fly   133 ELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWS 197
            .|.:  .|.:.:|..|    .|...:..:|..|.||||.|.|:||.||||||:.|.....|:.||
Zfish   138 GLGE--PESILEYKLD----DIKESMETVHRRLERSRQMQTFLRAFEARDRNLLEDNLWRVSFWS 196

  Fly   198 WAQFLSMIFVGFLQVLMVRSIFNTTGTFY 226
            ....|.::.|.|:||..:|.:|:.....|
Zfish   197 CVNLLVLLSVAFIQVYTLRRLFDDKRRVY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 69/196 (35%)
tmed1bNP_001074109.1 EMP24_GP25L 31..218 CDD:279450 69/195 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm6492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.