DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed5

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_083152.1 Gene:Tmed5 / 73130 MGIID:1921586 Length:229 Species:Mus musculus


Alignment Length:192 Identity:68/192 - (35%)
Similarity:105/192 - (54%) Gaps:3/192 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKRQMGKH 92
            :...|....|||:||||||:....:::|:|||:.|  ||..|:|:|..|..|.|:.|.::..|.|
Mouse    33 DSDFTFTLPAGRKECFYQPMPLKASLEIEYQVLDG--GELDIDFHLTSPEGRTLVFEQRKSDGVH 95

  Fly    93 SIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGIDSY 157
            :|: .|.|.|.||||||.||.::|::.|.|.:.....|.:...|.::.:......::....|...
Mouse    96 TIE-TEDGDYMFCFDNTFSTISEKVIFFELILDNMGEEVQGQEDWKKYITNTDVLEMKLEDILES 159

  Fly   158 VGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            :..|...|.:|...|..:||.||||||:.||.:..||.||....:.|:.|..:||..::|:|
Mouse   160 INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 68/190 (36%)
Tmed5NP_083152.1 EMP24_GP25L 35..222 CDD:279450 68/190 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm8870
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.910

Return to query results.
Submit another query.