DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed11

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_001071744.1 Gene:Tmed11 / 689712 RGDID:1588776 Length:214 Species:Rattus norvegicus


Alignment Length:228 Identity:49/228 - (21%)
Similarity:84/228 - (36%) Gaps:46/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLLDLKFSNAEPHNKQLTVFAEAGRQE--CFYQPIAT----TENIKI--------DYQVIHGG 63
            :||.....||.|        .:..||.:|  |..:.|.:    |...||        |:.....|
  Rat     6 ILLCFSFSFSAA--------FYFHAGEREEKCIIEDIPSDTLITGTFKIQQWDIGRHDFLESAPG 62

  Fly    64 LGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPAD 128
            ||    .|..:..:..:|:::.....|.....::.:|.:..|.::..:.|    |||      ..
  Rat    63 LG----MFVTVTNNDEVLLSKLYGAQGTFYFTSHSSGEHIICLESNSTQF----VSF------GG 113

  Fly   129 REERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLM-------RSRQTQDFIRAIEARDRNVA 186
            .:.|...|:|   :.::..|.........|.::...|.       :..:.||:.|..|...|..:
  Rat   114 SKLRIHLDIR---VGEHDLDAVIVQAKDKVNEVAFTLRHLIEQIEQILKEQDYQRDREENFRITS 175

  Fly   187 ESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            |.|...|..|::||.|..|.||..|:..::..|
  Rat   176 EDTNRNVLWWAFAQILIFISVGIFQMKHLKDFF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/211 (21%)
Tmed11XP_001071744.1 EMP24_GP25L 17..208 CDD:395878 44/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.