DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed7

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_079974.1 Gene:Tmed7 / 66676 MGIID:1913926 Length:224 Species:Mus musculus


Alignment Length:221 Identity:67/221 - (30%)
Similarity:97/221 - (43%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLM 74
            ||.|||||.     |.....::|.......::|||:.|.......:::|||.|  |...::..|.
Mouse    21 LLALLLLLP-----APSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITG--GHYDVDCRLE 78

  Fly    75 DPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVA---PADREERELRD 136
            ||..::|..|.|:|....:..|:..|:|||||.|..|||..|.|.|..:|.   |....|..:. 
Mouse    79 DPDGKVLYKEMKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVS- 142

  Fly   137 LRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQF 201
                         |.|.::|....||..|......|...|..||:.|:.||...:.|..||..:.
Mouse   143 -------------ALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEA 194

  Fly   202 LSMIFVGFLQVLMVRSIFN---TTGT 224
            |.::.|...||.:::|.|:   ||.|
Mouse   195 LILLVVSVGQVFLLKSFFSDKRTTTT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 55/192 (29%)
Tmed7NP_079974.1 EMP24_GP25L 36..213 CDD:307313 55/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103696
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.