DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed6

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_079734.1 Gene:Tmed6 / 66269 MGIID:1913519 Length:239 Species:Mus musculus


Alignment Length:252 Identity:64/252 - (25%)
Similarity:108/252 - (42%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRIARVIWLLQLLLLLDLKFSNAEP-H-NKQLTVFAEAGRQ-----------ECFYQPIATTEN 52
            ||.:..|..|:.|.|:..:|....:| | :|...:|..|.|.           |||:|.......
Mouse     1 MFPLLLVAELVVLSLVTSVKSQETDPLHGSKDQPLFRGADRNDFAIVVSPGAIECFWQFADQMGY 65

  Fly    53 IKIDYQV--IHGGLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFN- 114
            :...|:|  |.|...:.||......| :..||..::...|:.:....|||.|:.|..|..:.|: 
Mouse    66 LYFSYEVQRILGMSHDRHIVATAHTP-QGFLIDTSQDVRGQINFATQETGFYQLCLKNEQNRFSS 129

  Fly   115 -QKIVSFTL-----EVAPADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHV----NLMRSR 169
             |..::|.:     ||.....:.::|.| ..:.:.|     :...:::.|  .|:    |..|.|
Mouse   130 IQVYLNFGVFYEGPEVDHKQSQRKQLND-TLDAIKD-----STQRVENQV--FHMWRFYNYARMR 186

  Fly   170 QTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF--NTTGT 224
            :..||.         :.:|.|:.||.||.||.|:::..|.||:..::.:|  :||.|
Mouse   187 KVADFF---------LLQSNYTYVNWWSTAQSLAIVLSGALQLYFLKRLFTASTTDT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 51/215 (24%)
Tmed6NP_079734.1 EMP24_GP25L 43..227 CDD:279450 47/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.