DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed3

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_079636.2 Gene:Tmed3 / 66111 MGIID:1913361 Length:221 Species:Mus musculus


Alignment Length:211 Identity:70/211 - (33%)
Similarity:104/211 - (49%) Gaps:16/211 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLQLLLLLDLKFSNAEP-HNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNL 73
            ||||||||.|:   ||| .:.:||.......::||::.:.......:|||||.|  |...::..:
Mouse    14 LLQLLLLLLLR---AEPLRSAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITG--GHYDVDCYV 73

  Fly    74 MDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLR 138
            .||...::..|||:|....:.:....|.|:|||.|..|||:.|.|.|..:|..   |...|.|:.
Mouse    74 EDPRGNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYFDFQVGD---EPPILPDMG 135

  Fly   139 QEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLS 203
            ..:       .|.|.::|....||..|.....:|...|..||:||..||...|.|:.||..:.::
Mouse   136 NRV-------TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIA 193

  Fly   204 MIFVGFLQVLMVRSIF 219
            :..|.|.|||:::|.|
Mouse   194 LFVVSFSQVLLLKSFF 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 58/190 (31%)
Tmed3NP_079636.2 EMP24_GP25L 32..209 CDD:307313 57/188 (30%)
COPI vesicle coat-binding. /evidence=ECO:0000255 208..221 1/2 (50%)