DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed2

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_036021223.1 Gene:Tmed2 / 56334 MGIID:1929269 Length:208 Species:Mus musculus


Alignment Length:213 Identity:50/213 - (23%)
Similarity:103/213 - (48%) Gaps:11/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIWLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINF 71
            ::.|.:||.||....:.|..:    .|..:|..:|||::.:.:...:.:.::|..||.  ..|:.
Mouse     1 MVTLAELLALLAALLATASGY----FVSIDAHAEECFFERVTSGTKMGLIFEVAEGGF--LDIDV 59

  Fly    72 NLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRD 136
            .:..|..:.:....:...||::..|:..|:|||||.|.:||...|||.||:::..|.:.:    |
Mouse    60 EITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQ----D 120

  Fly   137 LRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQF 201
            :..|...| .:|.....::..:.::.|.:...:..|:::...|...|.:.::|.|.|..||:.:.
Mouse   121 METEGGGD-SWDAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEA 184

  Fly   202 LSMIFVGFLQVLMVRSIF 219
            |.::.:...|:..::..|
Mouse   185 LVLVAMTLGQIYYLKRFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/190 (23%)
Tmed2XP_036021223.1 EMP24_GP25L 23..203 CDD:395878 44/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.