DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed5

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_031755940.1 Gene:tmed5 / 549314 XenbaseID:XB-GENE-951292 Length:223 Species:Xenopus tropicalis


Alignment Length:184 Identity:65/184 - (35%)
Similarity:105/184 - (57%) Gaps:5/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AGRQECFYQPIATTENIKIDYQVIHG-GLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETG 100
            ||::|||:||:.....::|:|||:.| ||   .::|:|..|:..||::|.::..|.||::..: |
 Frog    36 AGQKECFFQPMKRDATLEIEYQVLDGAGL---DVDFSLTSPNGELLLSEERQSDGVHSVETID-G 96

  Fly   101 SYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNL 165
            .|:|||||:.|..::|::.|.|.:...:.|..||.|.:..:......|:....|...:..:...|
 Frog    97 DYQFCFDNSFSRMSEKVIFFELILDHLNDEGNELEDWKSYITGTDLLDMKLEDILETINSVKGRL 161

  Fly   166 MRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            .:|.|.|..::|.||||||:.||.:..|..||......|:.|..|||.|:||:|
 Frog   162 TKSAQIQTLLKAFEARDRNLQESNFERVTFWSVFNLTVMVVVSALQVYMLRSLF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 65/184 (35%)
tmed5XP_031755940.1 EMP24_GP25L 29..216 CDD:395878 65/184 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm9532
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.