DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and TMED7

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_861974.1 Gene:TMED7 / 51014 HGNCID:24253 Length:224 Species:Homo sapiens


Alignment Length:221 Identity:67/221 - (30%)
Similarity:99/221 - (44%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLM 74
            ||.||||:......:|     :|.......::|||:.||......:::|||.|  |...::..|.
Human    21 LLALLLLVPGPGGASE-----ITFELPDNAKQCFYEDIAQGTKCTLEFQVITG--GHYDVDCRLE 78

  Fly    75 DPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVA---PADREERELRD 136
            ||..::|..|.|:|....:..|::.|:|||||.|..|||..|.|.|..:|.   |....|..:. 
Human    79 DPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVS- 142

  Fly   137 LRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQF 201
                         |.|.::|....||..|......|...|..||:.|:.||...:.|..||..:.
Human   143 -------------ALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEA 194

  Fly   202 LSMIFVGFLQVLMVRSIFN---TTGT 224
            |.::.|...||.:::|.|:   ||.|
Human   195 LILLVVSIGQVFLLKSFFSDKRTTTT 220

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 56/192 (29%)
TMED7NP_861974.1 EMP24_GP25L 36..213 CDD:307313 57/197 (29%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..224 4/10 (40%)