DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and TMED5

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_057124.3 Gene:TMED5 / 50999 HGNCID:24251 Length:229 Species:Homo sapiens


Alignment Length:231 Identity:76/231 - (32%)
Similarity:117/231 - (50%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWL-LQLLLL-----------------LDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIK 54
            ||| ..:|||                 ||..|:...|          ||::||||||:....:::
Human     5 IWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLP----------AGQKECFYQPMPLKASLE 59

  Fly    55 IDYQVIHG-GLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIV 118
            |:|||:.| ||   .|:|:|..|..:.|:.|.::..|.|::: .|.|.|.||||||.||.::|::
Human    60 IEYQVLDGAGL---DIDFHLASPEGKTLVFEQRKSDGVHTVE-TEVGDYMFCFDNTFSTISEKVI 120

  Fly   119 SFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDR 183
            .|.|.:.....:.:|..|.::.:......|:....|...:..|...|.:|...|..:||.|||||
Human   121 FFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDR 185

  Fly   184 NVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            |:.||.:..||.||....:.|:.|..:||.|::|:|
Human   186 NIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 66/191 (35%)
TMED5NP_057124.3 EMP24_GP25L 35..222 CDD:279450 68/201 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm8638
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.