DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed1a

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001003487.1 Gene:tmed1a / 445093 ZFINID:ZDB-GENE-040801-229 Length:226 Species:Danio rerio


Alignment Length:236 Identity:75/236 - (31%)
Similarity:112/236 - (47%) Gaps:39/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIARVIWLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHG-GLGE 66
            |:| |.:|..|.|.|||.|:..:..:.:.|....||..|||:|......:::::||||.| ||  
Zfish     5 RLA-VCFLSFLTLCLDLGFTFGQNKDTEFTFLLPAGATECFFQTATKNSSMEVEYQVIAGSGL-- 66

  Fly    67 THINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIV------------- 118
             .:.|.|:.|....|:::.::..|.|::.:.|.|.|:.||||:.|..::|:|             
Zfish    67 -DVGFTLISPRGYRLVSDFRKSDGIHTVDSTEEGDYRICFDNSFSRISEKMVYVEVIMDGPEGED 130

  Fly   119 ----SFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIE 179
                .:.....|.|..|.:|.|:|..|                 ..:|.:|.||||.|..:||.|
Zfish   131 EDDEDWAALAEPEDSLEYKLEDIRDSM-----------------DAVHKSLERSRQLQTTLRAFE 178

  Fly   180 ARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIFN 220
            ||||.:.|.....|:.||.|..|.||.|...||..:|.:||
Zfish   179 ARDRYLLEDNLWRVSFWSCASLLVMISVALTQVYTLRRLFN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 63/207 (30%)
tmed1aNP_001003487.1 EMP24_GP25L 31..219 CDD:279450 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm6492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.