DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed7

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_989261.1 Gene:tmed7 / 394874 XenbaseID:XB-GENE-5847420 Length:219 Species:Xenopus tropicalis


Alignment Length:231 Identity:67/231 - (29%)
Similarity:96/231 - (41%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWLLQLLL--------LLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGL 64
            :|.||.|:        |..:.||.......:||.......::|||:.|.......:::|||.|  
 Frog     1 MWRLQGLVKEFRWWSFLSFVLFSLGCVRASELTFELPDNAKQCFYEDITQGTKCTLEFQVITG-- 63

  Fly    65 GETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVA---P 126
            |...::..|.||...:|..|.|:|....:..|...|:|||||.|..|||..|.|.|..:|.   |
 Frog    64 GHYDVDCRLEDPDGIVLYKEMKKQYDSFTFTATRNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPP 128

  Fly   127 ADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYS 191
            ....|...              .|.|.::|....||..|......|...|..||:.|:.||...|
 Frog   129 LFPNENRA--------------TALTQMESSCVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNS 179

  Fly   192 MVNKWSWAQFLSMIFVGFLQVLMVRSIFN---TTGT 224
            .|..||..:.:.::.|...||.:::|.|:   ||.|
 Frog   180 RVAYWSIGEAIILLVVSIGQVFLLKSFFSDKRTTTT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 56/192 (29%)
tmed7NP_989261.1 EMP24_GP25L 31..208 CDD:366467 56/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.