DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Ticam2

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102360.1 Gene:Ticam2 / 364867 RGDID:1308258 Length:232 Species:Rattus norvegicus


Alignment Length:155 Identity:31/155 - (20%)
Similarity:47/155 - (30%) Gaps:51/155 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKRQMGK---HSIQANET 99
            |.|.|.......:||......|:|..        .:..|     |.|..|...|   |..||.| 
  Rat    23 GDQGCHESDSKNSENASSPAFVVHSN--------GVEQP-----IGEQDRPEAKGEGHEEQAEE- 73

  Fly   100 GSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGI---DSYVGKI 161
                            :.:.|.:..|..|..|.    ||.:.|....|.:. .||   :...|::
  Rat    74 ----------------EFLKFVILHAEDDTNEA----LRVQNLLQNDFGIR-PGIVFAEMPCGRL 117

  Fly   162 HVNLMRSR----------QTQDFIR 176
            |:..:...          .|::|:|
  Rat   118 HLQNLDDAVNGSAWTILLLTENFLR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 31/155 (20%)
Ticam2NP_001102360.1 TIR_2 <115..>169 CDD:419986 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.