DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed3

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001122140.1 Gene:tmed3 / 336391 ZFINID:ZDB-GENE-030131-8335 Length:206 Species:Danio rerio


Alignment Length:216 Identity:66/216 - (30%)
Similarity:94/216 - (43%) Gaps:25/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFN----L 73
            |||.:.:.|.||    .:||.......::|||:.:.......||:|||.||      |::    :
Zfish     6 LLLAVYIAFVNA----TELTFELPDNEKQCFYEELEQGVKFDIDFQVIAGG------NYDVDCFV 60

  Fly    74 MDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLR 138
            .||...:|..|.|:|....|......|.||.||.|..|||:.|.|.........||         
Zfish    61 TDPINNMLYQERKKQYDSFSHTTVMKGVYKVCFSNEFSTFSHKTVYLDFRSGEDDR--------- 116

  Fly   139 QEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLS 203
              :..|.:...|.|.::|....||..|.....:|.:.|..||:||..||..:..|:.||..:.:.
Zfish   117 --LFPDQNRATALTQMESACLSIHEILKVVSDSQTWYRLREAQDRLRAEDLHERVHFWSIGETVI 179

  Fly   204 MIFVGFLQVLMVRSIFNTTGT 224
            :..|...||||::|.||...|
Zfish   180 LFVVCIGQVLMLKSFFNEKKT 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 57/193 (30%)
tmed3NP_001122140.1 EMP24_GP25L 19..196 CDD:279450 57/193 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.