DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and tmed2

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_021334783.1 Gene:tmed2 / 321550 ZFINID:ZDB-GENE-030131-269 Length:208 Species:Danio rerio


Alignment Length:187 Identity:46/187 - (24%)
Similarity:93/187 - (49%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKRQMGKHSIQAN 97
            |..:|..:||||:.:.:...:.:.::|..||.  ..|:..:..|..:.:....:...||:|:.|:
Zfish    23 VSIDAHAEECFYERVNSGTKMSLMFEVAEGGF--LDIDVKITGPDGKQIYKGDRESSGKYSVAAH 85

  Fly    98 ETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIH 162
            ..|:|||||.|.:||...|||.||:::..|.:.:    |:..|...| .:|.....::..:.::.
Zfish    86 MDGTYKFCFSNEMSTMTPKIVMFTIDIGEAPKGQ----DMETEGGGD-SWDAHQNKLEEMINELA 145

  Fly   163 VNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            |.:...:..|:::...|...|.:.::|.|.|..||:.:.|.::.:...|:..::..|
Zfish   146 VAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 46/187 (25%)
tmed2XP_021334783.1 EMP24_GP25L 20..203 CDD:307313 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.