DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and p24-1

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster


Alignment Length:209 Identity:57/209 - (27%)
Similarity:87/209 - (41%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NKQLTVFAEA-----------------GRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMD 75
            |.|:.|||.|                 ...:|||:.|....:...::||..|  |:..::..|.|
  Fly     2 NTQIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAG--GQLDVDVTLKD 64

  Fly    76 PSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQE 140
            |..:::.:..|.....|...|..||.|..||.|..|.|:.|||....:|.    ||..|..:   
  Fly    65 PQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVG----EEPALPGV--- 122

  Fly   141 MLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMI 205
               |.|..| .|.:::....||..|......|...|..||:.|..||.....|..||..:..::|
  Fly   123 ---DEHATV-LTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVI 183

  Fly   206 FVGFLQVLMVRSIF 219
            .:|.:|::::|:.|
  Fly   184 VIGLVQIMVLRNFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 56/207 (27%)
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 50/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454844
Domainoid 1 1.000 62 1.000 Domainoid score I2479
eggNOG 1 0.900 - - E1_KOG1693
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103696
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1789
109.780

Return to query results.
Submit another query.