DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and p24-2

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster


Alignment Length:205 Identity:40/205 - (19%)
Similarity:84/205 - (40%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QECFYQPIATTENIKIDYQV------IHG------GLGETHINFNLMDPSRRLLIAETKRQMGKH 92
            ::||.:.:.....:.::|:|      .:|      |:|   ::..:.|...:::::......|:.
  Fly    30 RKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIG---MHVEVRDSDDKIVLSRVYSSQGRI 91

  Fly    93 SIQANETGSYKFC-FDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGIDS 156
            |..::..|.:..| |.|:.:.|:...:...|::...:.........::|.||:..          
  Fly    92 SFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTELQ---------- 146

  Fly   157 YVGKIHVNLMRSRQTQDFIRAI----------EARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQ 211
                     :|.||..|.:..|          |.|.|:.:|||.|.|..||.||.:.::.:||..
  Fly   147 ---------LRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWH 202

  Fly   212 VLMVRSIFNT 221
            :.   ::|:|
  Fly   203 LF---NLFHT 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 38/202 (19%)
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 38/200 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.