DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and CHOp24

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:222 Identity:52/222 - (23%)
Similarity:100/222 - (45%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IARVIWLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETH 68
            :|:|:.|:..||:| .:.|:|      ..|..:|..:|||::.:.......:.::||.||.  ..
  Fly     5 LAKVLLLVGSLLIL-CRTSHA------FIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGF--LD 60

  Fly    69 INFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEV------APA 127
            ::..:..|...::....|...||::..|...|:|..||:|..|:...|:|.|:::|      ||.
  Fly    61 VDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPG 125

  Fly   128 DREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSM 192
            ...|.|               |.:|.::..:.::...|...:..|:::...:...|:|.|:|.|.
  Fly   126 APGEEE---------------VGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSR 175

  Fly   193 VNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            |..||..:.|.::.:...||..::..|
  Fly   176 VVLWSTFEALVLVLMTVGQVYYLKRFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/196 (22%)
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.