DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed6

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001099653.1 Gene:Tmed6 / 291991 RGDID:1305260 Length:238 Species:Rattus norvegicus


Alignment Length:247 Identity:56/247 - (22%)
Similarity:95/247 - (38%) Gaps:48/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRIARVIWLLQLLLLLDLKFSNAEP-HNKQ------------LTVFAEAGRQECFYQPIATTEN 52
            ||.:.....|:.|.|:...|....:| |..:            ..:....|..|||:|.......
  Rat     1 MFALLLEAGLVVLSLVTSAKSQRTDPLHGSKDQPLLRGADRHDFAIVVHPGNTECFWQFADQMGY 65

  Fly    53 IKIDYQVIH--GGLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFN- 114
            :...|:|..  |...:.||......| :..||..::...|:.:....|||.|:.|..|..:.|: 
  Rat    66 LYFSYEVQRTLGMSHDRHIVATAHTP-QGFLIDTSQDVRGQINFATQETGFYQLCLKNEQNRFSS 129

  Fly   115 -QKIVSFTL--EVAPADREERELRDLRQEMLTDYHFDVAYTGIDSYVGKI--HV-------NLMR 167
             |..::|.:  |....|.::.:.:.|...:          ..|:....::  ||       |..|
  Rat   130 IQVYLNFGVFYEGPEMDHKQSQRKQLNDTL----------DAIEDSTRRVQNHVFHMWRFYNSAR 184

  Fly   168 SRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219
            .|:..||.         :.:|.||.||.||.||.|:::..|.||:..::.:|
  Rat   185 MRKVADFF---------LLQSNYSYVNWWSTAQSLAIVLSGVLQLYFLKRLF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 48/217 (22%)
Tmed6NP_001099653.1 EMP24_GP25L 43..227 CDD:395878 47/203 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D501818at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.