DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed5

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001007620.1 Gene:Tmed5 / 289883 RGDID:1359437 Length:229 Species:Rattus norvegicus


Alignment Length:220 Identity:75/220 - (34%)
Similarity:114/220 - (51%) Gaps:11/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IWL-LQLLLLLDLK---FSNAEPHNKQL----TVFAEAGRQECFYQPIATTENIKIDYQVIHGGL 64
            :|| ..:|||..|.   .|.|......|    |....||::||||||:....:::|:|||:.|  
  Rat     5 MWLPFPMLLLSALPATLLSGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDG-- 67

  Fly    65 GETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADR 129
            ||..|:|:|..|..|.|:.|.::..|.|::: .|.|.|.||||||.||.::|::.|.|.:.....
  Rat    68 GELDIDFHLASPEGRTLVFEQRKSDGVHTVE-TEDGDYMFCFDNTFSTISEKVIFFELILDNMGE 131

  Fly   130 EERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVN 194
            |.....|.::.:......::....|...:..|...|.:|...|..:||.||||||:.||.:..||
  Rat   132 EVEGQEDWKKYITNTDVLEMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVN 196

  Fly   195 KWSWAQFLSMIFVGFLQVLMVRSIF 219
            .||....:.|:.|..:||..::|:|
  Rat   197 FWSVVNLMVMVVVSAIQVYTLKSLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 67/194 (35%)
Tmed5NP_001007620.1 EMP24_GP25L 35..222 CDD:279450 66/190 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm9115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.