DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and Tmed7

DIOPT Version :9

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001099228.1 Gene:Tmed7 / 252889 RGDID:727954 Length:226 Species:Rattus norvegicus


Alignment Length:222 Identity:65/222 - (29%)
Similarity:97/222 - (43%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNL 73
            |..:||.||.|..........::|.......::|||:.|.......:::|||.|  |...::..|
  Rat    17 WSCRLLALLLLLLLPGPSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITG--GHYDVDCRL 79

  Fly    74 MDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVA---PADREERELR 135
            .||..::|..|.|:|....:..|::.|:|||||.|..|||..|.|.|..:|.   |....|..:.
  Rat    80 EDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVS 144

  Fly   136 DLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQ 200
                          |.|.::|....||..|......|...|..||:.|:.||...:.|..||..:
  Rat   145 --------------ALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGE 195

  Fly   201 FLSMIFVGFLQVLMVRSIFN---TTGT 224
            .|.::.|...||.:::|.|:   ||.|
  Rat   196 ALILLVVSIGQVFLLKSFFSDKRTTTT 222

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 55/192 (29%)
Tmed7NP_001099228.1 EMP24_GP25L 38..214 CDD:395878 55/191 (29%)
COPI vesicle coat-binding. /evidence=ECO:0000255 213..226 4/10 (40%)