DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31787 and TMED3

DIOPT Version :10

Sequence 1:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_031390.1 Gene:TMED3 / 23423 HGNCID:28889 Length:217 Species:Homo sapiens


Alignment Length:207 Identity:66/207 - (31%)
Similarity:100/207 - (48%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPS 77
            |||||.|:.:. :|...:||.......::||::.:.......:|||||.|  |...::..:.||.
Human    12 LLLLLLLRRAE-QPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITG--GHYDVDCYVEDPQ 73

  Fly    78 RRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEML 142
            ...:..|||:|....:.:|...|.|:|||.|..|||:.|.|.|..:|..   |...|.|:...: 
Human    74 GNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGD---EPPILPDMGNRV- 134

  Fly   143 TDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFV 207
                  .|.|.::|....||..|.....:|...|..||:||..||...|.|:.||..:.:::..|
Human   135 ------TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVV 193

  Fly   208 GFLQVLMVRSIF 219
            .|.|||:::|.|
Human   194 SFSQVLLLKSFF 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31787NP_724105.1 EMP24_GP25L 31..220 CDD:426051 59/189 (31%)
TMED3NP_031390.1 EMP24_GP25L 28..205 CDD:426051 58/188 (31%)
COPI vesicle coat-binding. /evidence=ECO:0000255 204..217 1/2 (50%)